Lineage for d1yl3n1 (1yl3 N:1-122)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057998Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2057999Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2058000Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2058001Protein Ribosomal protein L14 [50195] (5 species)
  7. 2058084Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 2058094Domain d1yl3n1: 1yl3 N:1-122 [123589]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3n1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (N:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1yl3n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3n1 b.39.1.1 (N:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOPe Domain Coordinates for d1yl3n1:

Click to download the PDB-style file with coordinates for d1yl3n1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3n1: