SCOP 1.73: Domain d1yl3l2: 1yl3 L:8-70

Lineage for d1yl3l2 (1yl3 L:8-70)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [54750] (6 PDB entries)

8. Domain d1yl3l2: 1yl3 L:8-70 [123587]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1mmsa2

Details for d1yl3l2

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (L:) 50S ribosomal protein L11

SCOP Domain Sequences for d1yl3l2:

Sequence; same for both SEQRES and ATOM records:

>d1yl3l2 d.47.1.1 (L:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

Timeline for d1yl3l2:

• d1yl3l2 is new in SCOP 1.73
  
• d1yl3l2 appears in SCOP 1.75
  
• d1yl3l2 appears in the current release, SCOPe 2.08