Lineage for d1yl3l1 (1yl3 L:71-140)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080806Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1080807Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1080808Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1080899Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 1080916Domain d1yl3l1: 1yl3 L:71-140 [123586]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to d1mmsa1

Details for d1yl3l1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1yl3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3l1 a.4.7.1 (L:71-140) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOPe Domain Coordinates for d1yl3l1:

Click to download the PDB-style file with coordinates for d1yl3l1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3l1: