SCOP 1.73: Domain d1yl3l1: 1yl3 L:71-140

Lineage for d1yl3l1 (1yl3 L:71-140)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [46910] (5 PDB entries)

8. Domain d1yl3l1: 1yl3 L:71-140 [123586]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1mmsa1

Details for d1yl3l1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (L:) 50S ribosomal protein L11

SCOP Domain Sequences for d1yl3l1:

Sequence; same for both SEQRES and ATOM records:

>d1yl3l1 a.4.7.1 (L:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

Timeline for d1yl3l1:

• d1yl3l1 is new in SCOP 1.73
  
• d1yl3l1 appears in SCOP 1.75
  
• d1yl3l1 appears in the current release, SCOPe 2.08