Lineage for d1yl3k2 (1yl3 K:1-55)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214149Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1214150Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1214151Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 1214152Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 1214190Species Thermus thermophilus [TaxId:274] [143636] (9 PDB entries)
    Uniprot Q5SLQ1 1-55
  8. 1214196Domain d1yl3k2: 1yl3 K:1-55 [123585]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to d1cqua_

Details for d1yl3k2

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (K:) 50S ribosomal protein L9

SCOPe Domain Sequences for d1yl3k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3k2 d.100.1.1 (K:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOPe Domain Coordinates for d1yl3k2:

Click to download the PDB-style file with coordinates for d1yl3k2.
(The format of our PDB-style files is described here.)

Timeline for d1yl3k2: