SCOP 1.73: Domain d1yl3k2: 1yl3 K:1-55

Lineage for d1yl3k2 (1yl3 K:1-55)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.100: L9 N-domain-like [55657] (1 superfamily)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (7 PDB entries)

8. Domain d1yl3k2: 1yl3 K:1-55 [123585]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1cqua_

Details for d1yl3k2

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (K:) 50S ribosomal protein L9

SCOP Domain Sequences for d1yl3k2:

Sequence; same for both SEQRES and ATOM records:

>d1yl3k2 d.100.1.1 (K:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

Timeline for d1yl3k2:

• d1yl3k2 is new in SCOP 1.73
  
• d1yl3k2 appears in SCOP 1.75
  
• d1yl3k2 appears in the current release, SCOPe 2.08