SCOP 1.73: Domain d1yl3k1: 1yl3 K:56-149

Lineage for d1yl3k1 (1yl3 K:56-149)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries)

8. Domain d1yl3k1: 1yl3 K:56-149 [123584]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1div_1

Details for d1yl3k1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (K:) 50S ribosomal protein L9

SCOP Domain Sequences for d1yl3k1:

Sequence, based on SEQRES records:

>d1yl3k1 d.99.1.1 (K:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records):

>d1yl3k1 d.99.1.1 (K:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

Timeline for d1yl3k1:

• d1yl3k1 is new in SCOP 1.73
  
• d1yl3k1 appears in SCOP 1.75
  
• d1yl3k1 appears in the current release, SCOPe 2.08