SCOP 1.73: Domain d1yl3j2: 1yl3 J:58-128

Lineage for d1yl3j2 (1yl3 J:58-128)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (2 families)

5. Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)

6. Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)

8. Domain d1yl3j2: 1yl3 J:58-128 [123583]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3j1, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1dd3a2

Details for d1yl3j2

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (J:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1yl3j2:

Sequence; same for both SEQRES and ATOM records:

>d1yl3j2 d.45.1.1 (J:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

Timeline for d1yl3j2:

• d1yl3j2 is new in SCOP 1.73
  
• d1yl3j2 appears in SCOP 1.75
  
• d1yl3j2 appears in the current release, SCOPe 2.08