Lineage for d1yl3j1 (1yl3 J:1-57)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646594Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 646595Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 646596Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 646597Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 646609Species Thermotoga maritima [TaxId:2336] [48303] (3 PDB entries)
  8. 646619Domain d1yl3j1: 1yl3 J:1-57 [123582]
    Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i2, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
    automatically matched to d1dd3a1

Details for d1yl3j1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (J:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1yl3j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3j1 a.108.1.1 (J:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOP Domain Coordinates for d1yl3j1:

Click to download the PDB-style file with coordinates for d1yl3j1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3j1: