Lineage for d1yl3i2 (1yl3 I:58-128)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904037Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 1904038Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 1904039Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
    automatically mapped to Pfam PF00542
  6. 1904040Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)
  7. 1904055Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)
  8. 1904060Domain d1yl3i2: 1yl3 I:58-128 [123581]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3j1, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3i2

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (I:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1yl3i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3i2 d.45.1.1 (I:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

SCOPe Domain Coordinates for d1yl3i2:

Click to download the PDB-style file with coordinates for d1yl3i2.
(The format of our PDB-style files is described here.)

Timeline for d1yl3i2: