Lineage for d1yl3h2 (1yl3 H:82-170)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217079Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2217080Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2217081Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2217082Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2217237Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 2217261Domain d1yl3h2: 1yl3 H:82-170 [123579]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3h2

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1yl3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3h2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

SCOPe Domain Coordinates for d1yl3h2:

Click to download the PDB-style file with coordinates for d1yl3h2.
(The format of our PDB-style files is described here.)

Timeline for d1yl3h2: