SCOPe 2.05: Domain d1yl3h2: 1yl3 H:82-170

Lineage for d1yl3h2 (1yl3 H:82-170)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d1yl3h2: 1yl3 H:82-170 [123579]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3h2

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1yl3h2:

Sequence; same for both SEQRES and ATOM records:

>d1yl3h2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg
elaaniravrppepykgkgiryegelvrl

Timeline for d1yl3h2:

• d1yl3h2 first appeared in SCOP 1.73
  
• d1yl3h2 appears in SCOPe 2.04
  
• d1yl3h2 appears in SCOPe 2.06
  
• d1yl3h2 appears in the current release, SCOPe 2.08