![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (2 species) duplication: consists of two domains of this fold |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries) |
![]() | Domain d1yl3h2: 1yl3 H:82-170 [123579] Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1 automatically matched to d1rl6a2 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOP Domain Sequences for d1yl3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl3h2 d.141.1.1 (H:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} yekalelvgvgyraskqgkklvlsvgyshpveiepeegleievpsqtkiivkgadkqrvg elaaniravrppepykgkgiryegelvrl
Timeline for d1yl3h2: