![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries) |
![]() | Domain d1yl3h1: 1yl3 H:7-81 [123578] Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 automatically matched to d1rl6a1 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOP Domain Sequences for d1yl3h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl3h1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt trsllanmvegvskg
Timeline for d1yl3h1:
![]() Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |