SCOP 1.73: Domain d1yl3h1: 1yl3 H:7-81

Lineage for d1yl3h1 (1yl3 H:7-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Bacillus stearothermophilus [TaxId:1422] [56056] (5 PDB entries)

8. Domain d1yl3h1: 1yl3 H:7-81 [123578]
   Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1
   automatically matched to d1rl6a1

Details for d1yl3h1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d1yl3h1:

Sequence; same for both SEQRES and ATOM records:

>d1yl3h1 d.141.1.1 (H:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskg

Timeline for d1yl3h1:

• d1yl3h1 is new in SCOP 1.73
  
• d1yl3h1 appears in SCOP 1.75
  
• d1yl3h1 appears in the current release, SCOPe 2.08