SCOPe 2.01: Domain d1yl3f1: 1yl3 F:1-246

Lineage for d1yl3f1 (1yl3 F:1-246)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries)
   Uniprot P12735

8. Domain d1yl3f1: 1yl3 F:1-246 [123577]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
   automatically matched to d1ffkc_

Details for d1yl3f1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d1yl3f1:

Sequence, based on SEQRES records:

>d1yl3f1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Sequence, based on observed residues (ATOM records):

>d1yl3f1 c.22.1.1 (F:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs
grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk
tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte
salaevaer

Timeline for d1yl3f1:

• d1yl3f1 first appeared in SCOP 1.73
  
• d1yl3f1 appears in SCOP 1.75
  
• d1yl3f1 appears in SCOPe 2.02
  
• d1yl3f1 appears in the current release, SCOPe 2.07