SCOP 1.75: Domain d1yl3d2: 1yl3 D:60-125

Lineage for d1yl3d2 (1yl3 D:60-125)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Bacillus stearothermophilus [TaxId:1422] [50300] (2 PDB entries)

8. Domain d1yl3d2: 1yl3 D:60-125 [123576]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
   automatically matched to d1rl2a2

Details for d1yl3d2

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d1yl3d2:

Sequence; same for both SEQRES and ATOM records:

>d1yl3d2 b.40.4.5 (D:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadiki

Timeline for d1yl3d2:

• d1yl3d2 first appeared in SCOP 1.73
  
• d1yl3d2 appears in SCOPe 2.01
  
• d1yl3d2 appears in the current release, SCOPe 2.08