Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) incomplete OB-fold lacking the last strand |
Species Bacillus stearothermophilus [TaxId:1422] [50300] (2 PDB entries) |
Domain d1yl3d2: 1yl3 D:60-125 [123576] Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3w1, d1yl3x1 automatically matched to d1rl2a2 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOP Domain Sequences for d1yl3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl3d2 b.40.4.5 (D:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]} qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp dadiki
Timeline for d1yl3d2: