SCOPe 2.06: Domain d1yl3d1: 1yl3 D:126-196

Lineage for d1yl3d1 (1yl3 D:126-196)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Thermus thermophilus [TaxId:274] [159026] (6 PDB entries)
   Uniprot Q72I07 126-272

8. Domain d1yl3d1: 1yl3 D:126-196 [123575]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3d1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1yl3d1:

Sequence; same for both SEQRES and ATOM records:

>d1yl3d1 b.34.5.3 (D:126-196) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevgn

Timeline for d1yl3d1:

• d1yl3d1 first appeared in SCOP 1.73
  
• d1yl3d1 appears in SCOPe 2.05
  
• d1yl3d1 appears in SCOPe 2.07
  
• d1yl3d1 appears in the current release, SCOPe 2.08