Lineage for d1yl3d1 (1yl3 D:126-196)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796751Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 796752Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 796794Species Bacillus stearothermophilus [TaxId:1422] [50116] (2 PDB entries)
  8. 796797Domain d1yl3d1: 1yl3 D:126-196 [123575]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to d1rl2b1

Details for d1yl3d1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d1yl3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3d1 b.34.5.3 (D:126-196) C-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
gnalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasgevrmilg
kcratvgevgn

SCOP Domain Coordinates for d1yl3d1:

Click to download the PDB-style file with coordinates for d1yl3d1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3d1: