Lineage for d1ykwb2 (1ykw B:4-145)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909193Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1909194Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1909200Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries)
    Uniprot Q8KBL4 1-428
  8. 1909202Domain d1ykwb2: 1ykw B:4-145 [123568]
    Other proteins in same PDB: d1ykwa1, d1ykwb1
    automated match to d1ykwa2

Details for d1ykwb2

PDB Entry: 1ykw (more details), 2 Å

PDB Description: crystal structure of a novel rubisco-like protein from the green sulfur bacterium chlorobium tepidum
PDB Compounds: (B:) RuBisCO-like protein

SCOPe Domain Sequences for d1ykwb2:

Sequence, based on SEQRES records: (download)

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfrlvh
aakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyf
tpgvpvvklmdihfpdtyladf

Sequence, based on observed residues (ATOM records): (download)

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie
eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd
ihfpdtyladf

SCOPe Domain Coordinates for d1ykwb2:

Click to download the PDB-style file with coordinates for d1ykwb2.
(The format of our PDB-style files is described here.)

Timeline for d1ykwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykwb1