Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries) Uniprot Q8KBL4 1-428 |
Domain d1ykwb2: 1ykw B:4-145 [123568] Other proteins in same PDB: d1ykwa1, d1ykwb1 automated match to d1ykwa2 |
PDB Entry: 1ykw (more details), 2 Å
SCOPe Domain Sequences for d1ykwb2:
Sequence, based on SEQRES records: (download)
>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} edvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfrlvh aakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyf tpgvpvvklmdihfpdtyladf
>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd ihfpdtyladf
Timeline for d1ykwb2: