SCOP 1.75: Domain d1ykwb2: 1ykw B:4-145

Lineage for d1ykwb2 (1ykw B:4-145)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries)
   Uniprot Q8KBL4 1-428

8. Domain d1ykwb2: 1ykw B:4-145 [123568]
   Other proteins in same PDB: d1ykwa1, d1ykwb1
   automatically matched to 1YKW A:4-145
   mutant

Details for d1ykwb2

PDB Entry: 1ykw, 2 Å

PDB Description: crystal structure of a novel rubisco-like protein from the green sulfur bacterium chlorobium tepidum

PDB Compounds: (B:) RuBisCO-like protein

SCOP Domain Sequences for d1ykwb2:

Sequence, based on SEQRES records:

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfrlvh
aakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyf
tpgvpvvklmdihfpdtyladf

Sequence, based on observed residues (ATOM records):

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie
eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd
ihfpdtyladf

Timeline for d1ykwb2:

• d1ykwb2 first appeared in SCOP 1.73
  
• d1ykwb2 appears in SCOPe 2.01
  
• d1ykwb2 appears in the current release, SCOPe 2.08