Lineage for d1ykwb2 (1ykw B:4-145)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862648Species Chlorobium tepidum [TaxId:1097] [117975] (2 PDB entries)
    Uniprot Q8KBL4 1-428
  8. 862650Domain d1ykwb2: 1ykw B:4-145 [123568]
    Other proteins in same PDB: d1ykwa1, d1ykwb1
    automatically matched to 1YKW A:4-145
    mutant

Details for d1ykwb2

PDB Entry: 1ykw (more details), 2 Å

PDB Description: crystal structure of a novel rubisco-like protein from the green sulfur bacterium chlorobium tepidum
PDB Compounds: (B:) RuBisCO-like protein

SCOP Domain Sequences for d1ykwb2:

Sequence, based on SEQRES records: (download)

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfrlvh
aakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyf
tpgvpvvklmdihfpdtyladf

Sequence, based on observed residues (ATOM records): (download)

>d1ykwb2 d.58.9.1 (B:4-145) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
edvkgffasresldmeqylvldyylesvgdietalahfcseqstfrlvhaakvidyevie
eleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgegtyftpgvpvvklmd
ihfpdtyladf

SCOP Domain Coordinates for d1ykwb2:

Click to download the PDB-style file with coordinates for d1ykwb2.
(The format of our PDB-style files is described here.)

Timeline for d1ykwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykwb1