Lineage for d1ykwa1 (1ykw A:146-428)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973964Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 973965Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 973966Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 973972Species Chlorobium tepidum [TaxId:1097] [117389] (2 PDB entries)
    Uniprot Q8KBL4 1-428
  8. 973973Domain d1ykwa1: 1ykw A:146-428 [123565]
    Other proteins in same PDB: d1ykwa2, d1ykwb2

Details for d1ykwa1

PDB Entry: 1ykw (more details), 2 Å

PDB Description: crystal structure of a novel rubisco-like protein from the green sulfur bacterium chlorobium tepidum
PDB Compounds: (A:) RuBisCO-like protein

SCOPe Domain Sequences for d1ykwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]}
egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad
vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina
lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg
drvmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv
fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq

SCOPe Domain Coordinates for d1ykwa1:

Click to download the PDB-style file with coordinates for d1ykwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ykwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykwa2