![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) ![]() |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) N-terminal domain is alpha+beta |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species) |
![]() | Species Chlorobium tepidum [TaxId:1097] [117389] (2 PDB entries) Uniprot Q8KBL4 1-428 |
![]() | Domain d1ykwa1: 1ykw A:146-428 [123565] Other proteins in same PDB: d1ykwa2, d1ykwb2 mutant |
PDB Entry: 1ykw (more details), 2 Å
SCOP Domain Sequences for d1ykwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} egpkfgieglrdilnahgrpiffgvvkpniglspgefaeiayqswlggldiakddemlad vtwssieeraahlgkarrkaeaetgepkiylanitdevdslmekhdvavrnganallina lpvglsavrmlsnytqvplighfpfiasfsrmekygihskvmtklqrlagldavimpgfg drvmtpeeevlenviectkpmgrikpclpvpggsdsaltlqtvyekvgnvdfgfvpgrgv fghpmgpkagaksirqaweaieqgisietwaethpelqamvdq
Timeline for d1ykwa1: