SCOP 1.73: Domain d1ykta1: 1ykt A:16-245

Lineage for d1ykta1 (1ykt A:16-245)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)

8. Domain d1ykta1: 1ykt A:16-245 [123563]
   Other proteins in same PDB: d1yktb1
   automatically matched to d3tgje_
   complexed with ca, so4; mutant

Details for d1ykta1

PDB Entry: 1ykt, 1.7 Å

PDB Description: trypsin/bpti complex mutant

PDB Compounds: (A:) trypsin II

SCOP Domain Sequences for d1ykta1:

Sequence; same for both SEQRES and ATOM records:

>d1ykta1 b.47.1.2 (A:16-245) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ykta1:

• d1ykta1 is new in SCOP 1.73
  
• d1ykta1 appears in SCOP 1.75
  
• d1ykta1 appears in the current release, SCOPe 2.08, called d1ykta_