Class b: All beta proteins [48724] (165 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
Species Pseudomonas aeruginosa [TaxId:287] [49487] (21 PDB entries) |
Domain d1ykpe1: 1ykp E:1-200 [123556] automatically matched to d2pcda_ complexed with dhb, fe; mutant |
PDB Entry: 1ykp (more details), 2.41 Å
SCOP Domain Sequences for d1ykpe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykpe1 b.3.6.1 (E:1-200) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa [TaxId: 287]} piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk tayrfdiriqgegetvffdf
Timeline for d1ykpe1: