Lineage for d1ykni_ (1ykn I:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365897Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2365898Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2365921Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2365929Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2365946Domain d1ykni_: 1ykn I: [123546]
    Other proteins in same PDB: d1yknb_, d1yknd_, d1yknf_, d1yknh_, d1yknj_, d1yknl_
    automated match to d2pcda_
    complexed with dhb, fe; mutant

Details for d1ykni_

PDB Entry: 1ykn (more details), 2.06 Å

PDB Description: Protocatechuate 3,4-dioxygenase Y408E mutant bound to DHB
PDB Compounds: (I:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1ykni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykni_ b.3.6.1 (I:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d1ykni_:

Click to download the PDB-style file with coordinates for d1ykni_.
(The format of our PDB-style files is described here.)

Timeline for d1ykni_: