Lineage for d1ykmi_ (1ykm I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2769913Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2769921Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2769956Domain d1ykmi_: 1ykm I: [123540]
    Other proteins in same PDB: d1ykmb1, d1ykmd_, d1ykmf_, d1ykmh_, d1ykmj_, d1ykml_
    automated match to d2pcda_
    complexed with fe; mutant

Details for d1ykmi_

PDB Entry: 1ykm (more details), 2.22 Å

PDB Description: protocatechuate 3,4-dioxygenase y408e mutant
PDB Compounds: (I:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1ykmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykmi_ b.3.6.1 (I:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d1ykmi_:

Click to download the PDB-style file with coordinates for d1ykmi_.
(The format of our PDB-style files is described here.)

Timeline for d1ykmi_: