Lineage for d1ykmc_ (1ykm C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773665Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1773673Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 1773753Domain d1ykmc_: 1ykm C: [123537]
    Other proteins in same PDB: d1ykmb1, d1ykmd_, d1ykmf_, d1ykmh_, d1ykmj_, d1ykml_
    automated match to d2pcda_
    complexed with fe; mutant

Details for d1ykmc_

PDB Entry: 1ykm (more details), 2.22 Å

PDB Description: protocatechuate 3,4-dioxygenase y408e mutant
PDB Compounds: (C:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1ykmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykmc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d1ykmc_:

Click to download the PDB-style file with coordinates for d1ykmc_.
(The format of our PDB-style files is described here.)

Timeline for d1ykmc_: