Lineage for d1ykkg1 (1ykk G:1-200)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660221Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 660235Species Pseudomonas aeruginosa [TaxId:287] [49487] (21 PDB entries)
  8. 660305Domain d1ykkg1: 1ykk G:1-200 [123527]
    automatically matched to d2pcda_
    complexed with fe; mutant

Details for d1ykkg1

PDB Entry: 1ykk (more details), 2.06 Å

PDB Description: protocatechuate 3,4-dioxygenase y408c mutant
PDB Compounds: (G:) protocatechuate 3,4-dioxygenase alpha chain

SCOP Domain Sequences for d1ykkg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykkg1 b.3.6.1 (G:1-200) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa [TaxId: 287]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d1ykkg1:

Click to download the PDB-style file with coordinates for d1ykkg1.
(The format of our PDB-style files is described here.)

Timeline for d1ykkg1: