Lineage for d1ykka1 (1ykk A:1-200)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790824Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 790842Species Pseudomonas putida [TaxId:303] [49487] (21 PDB entries)
  8. 790921Domain d1ykka1: 1ykk A:1-200 [123524]
    Other proteins in same PDB: d1ykkb1, d1ykkd1, d1ykkf1, d1ykkh1, d1ykkj1, d1ykkl1
    automatically matched to d2pcda_
    complexed with fe; mutant

Details for d1ykka1

PDB Entry: 1ykk (more details), 2.06 Å

PDB Description: protocatechuate 3,4-dioxygenase y408c mutant
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOP Domain Sequences for d1ykka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykka1 b.3.6.1 (A:1-200) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d1ykka1:

Click to download the PDB-style file with coordinates for d1ykka1.
(The format of our PDB-style files is described here.)

Timeline for d1ykka1: