Lineage for d1ykid_ (1yki D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. Protein automated matches [190153] (5 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [186877] (3 PDB entries)
  8. Domain d1ykid_: 1yki D: [123523]
    automated match to d1ds7a_
    complexed with cit, dms, fmn, nfz

Details for d1ykid_

PDB Entry: 1yki (more details), 1.7 Å

PDB Description: The structure of E. coli nitroreductase bound with the antibiotic nitrofurazone
PDB Compounds: (D:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d1ykid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykid_ d.90.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d1ykid_ are not available.

Timeline for d1ykid_:

Domains from other chains:
(mouse over for more information)
d1ykia_, d1ykib_, d1ykic_