Lineage for d1ykic_ (1yki C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963381Protein automated matches [190153] (5 species)
    not a true protein
  7. 2963391Species Escherichia coli [TaxId:562] [186877] (3 PDB entries)
  8. 2963394Domain d1ykic_: 1yki C: [123522]
    automated match to d1ds7a_
    complexed with cit, dms, fmn, nfz

Details for d1ykic_

PDB Entry: 1yki (more details), 1.7 Å

PDB Description: The structure of E. coli nitroreductase bound with the antibiotic nitrofurazone
PDB Compounds: (C:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d1ykic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykic_ d.90.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
gytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d1ykic_:

Click to download the PDB-style file with coordinates for d1ykic_.
(The format of our PDB-style files is described here.)

Timeline for d1ykic_: