SCOPe 2.08: Domain d1ykhb1: 1ykh B:2-130

Lineage for d1ykhb1 (1ykh B:2-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
   6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure

4. Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families)

5. Family a.252.1.1: CSE2-like [140719] (1 protein)
   Pfam PF07544

6. Protein RNA polymerase II holoenzyme component SRB7 (MED21) [140720] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140721] (2 PDB entries)
   Uniprot P47822 2-130! Uniprot P47822 3-133

8. Domain d1ykhb1: 1ykh B:2-130 [123519]
   Other proteins in same PDB: d1ykha_

Details for d1ykhb1

PDB Entry: 1ykh, 3 Å

PDB Description: structure of the mediator med7/med21 (med7/srb7) subcomplex

PDB Compounds: (B:) RNA polymerase II holoenzyme component SRB7

SCOPe Domain Sequences for d1ykhb1:

Sequence, based on SEQRES records:

>d1ykhb1 a.252.1.1 (B:2-130) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdrmtqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntide
lstdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkeklmrh
vdsmiedfv

Sequence, based on observed residues (ATOM records):

>d1ykhb1 a.252.1.1 (B:2-130) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdrmtqlqicldqmteqfcatlnyidknhgfevvppeefsntidelstdiilktrqinkl
idslpgvdvsaeeqlrkidmlqkklvevedekieaikkkeklmrhvdsmiedfv

Timeline for d1ykhb1:

• d1ykhb1 first appeared in SCOP 1.73
  
• d1ykhb1 appears in SCOPe 2.07