SCOPe 2.08: Domain d1ykha_: 1ykh A:

Lineage for d1ykha_ (1ykh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
   6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure

4. Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families)

5. Family a.252.1.2: MED7 hinge region [140722] (2 proteins)
   C-terminal part of Pfam PF05983

6. Protein automated matches [254458] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254982] (1 PDB entry)

8. Domain d1ykha_: 1ykh A: [123518]
   Other proteins in same PDB: d1ykhb1
   automated match to d1ykea1

Details for d1ykha_

PDB Entry: 1ykh, 3 Å

PDB Description: structure of the mediator med7/med21 (med7/srb7) subcomplex

PDB Compounds: (A:) RNA polymerase II mediator complex protein MED7

SCOPe Domain Sequences for d1ykha_:

Sequence; same for both SEQRES and ATOM records:

>d1ykha_ a.252.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrphqs
reslimlleeqleykrgeireieqvckqvhdklts

Timeline for d1ykha_:

• d1ykha_ first appeared in SCOP 1.73, called d1ykha1
  
• d1ykha_ appears in SCOPe 2.07