Lineage for d1ykha_ (1ykh A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016118Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
    6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure
  4. 2016119Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) (S)
  5. 2016126Family a.252.1.2: MED7 hinge region [140722] (2 protein domains)
    C-terminal part of Pfam PF05983
  6. 2016131Protein automated matches [254458] (1 species)
    not a true protein
  7. 2016132Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254982] (1 PDB entry)
  8. 2016133Domain d1ykha_: 1ykh A: [123518]
    Other proteins in same PDB: d1ykhb1
    automated match to d1ykea1

Details for d1ykha_

PDB Entry: 1ykh (more details), 3 Å

PDB Description: Structure of the mediator MED7/MED21 (Med7/Srb7) subcomplex
PDB Compounds: (A:) RNA polymerase II mediator complex protein MED7

SCOPe Domain Sequences for d1ykha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykha_ a.252.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrphqs
reslimlleeqleykrgeireieqvckqvhdklts

SCOPe Domain Coordinates for d1ykha_:

Click to download the PDB-style file with coordinates for d1ykha_.
(The format of our PDB-style files is described here.)

Timeline for d1ykha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ykhb1