![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily) 6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure |
![]() | Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) ![]() |
![]() | Family a.252.1.2: MED7 hinge region [140722] (2 proteins) C-terminal part of Pfam PF05983 |
![]() | Protein automated matches [254458] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254982] (1 PDB entry) |
![]() | Domain d1ykha_: 1ykh A: [123518] Other proteins in same PDB: d1ykhb1 automated match to d1ykea1 |
PDB Entry: 1ykh (more details), 3 Å
SCOPe Domain Sequences for d1ykha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykha_ a.252.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrphqs reslimlleeqleykrgeireieqvckqvhdklts
Timeline for d1ykha_: