Lineage for d1ykga1 (1ykg A:63-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464767Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)
  6. 2464783Protein Sulfite reductase alpha-component CysJ N-terminal domain [142049] (1 species)
  7. 2464784Species Escherichia coli [TaxId:562] [142050] (1 PDB entry)
    Uniprot P38038 63-208
  8. 2464785Domain d1ykga1: 1ykg A:63-208 [123517]
    N-domain only; the structures of the other domains are also known ((50442), 52369)
    complexed with fmn

Details for d1ykga1

PDB Entry: 1ykg (more details)

PDB Description: solution structure of the flavodoxin-like domain from the escherichia coli sulfite reductase
PDB Compounds: (A:) sulfite reductase [nadph] flavoprotein alpha-component

SCOPe Domain Sequences for d1ykga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]}
itiisasqtgnarrvaealrddllaaklnvklvnagdykfkqiasekllivvtstqgege
ppeeavalhkflfskkapklentafavfslgdtsyeffcqsgkdfdsklaelggerlldr
vdadveyqaaasewrarvvdalksra

SCOPe Domain Coordinates for d1ykga1:

Click to download the PDB-style file with coordinates for d1ykga1.
(The format of our PDB-style files is described here.)

Timeline for d1ykga1: