SCOPe 2.08: Domain d1ykga1: 1ykg A:63-208

Lineage for d1ykga1 (1ykg A:63-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)

6. Protein Sulfite reductase alpha-component CysJ N-terminal domain [142049] (1 species)

7. Species Escherichia coli [TaxId:562] [142050] (1 PDB entry)
   Uniprot P38038 63-208

8. Domain d1ykga1: 1ykg A:63-208 [123517]
   N-domain only; the structures of the other domains are also known ((50442), 52369)
   complexed with fmn

Details for d1ykga1

PDB Entry: 1ykg

PDB Description: solution structure of the flavodoxin-like domain from the escherichia coli sulfite reductase

PDB Compounds: (A:) sulfite reductase [nadph] flavoprotein alpha-component

SCOPe Domain Sequences for d1ykga1:

Sequence; same for both SEQRES and ATOM records:

>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]}
itiisasqtgnarrvaealrddllaaklnvklvnagdykfkqiasekllivvtstqgege
ppeeavalhkflfskkapklentafavfslgdtsyeffcqsgkdfdsklaelggerlldr
vdadveyqaaasewrarvvdalksra

Timeline for d1ykga1:

• d1ykga1 first appeared in SCOP 1.73
  
• d1ykga1 appears in SCOPe 2.07