SCOP 1.73: Domain d1yked1: 1yke D:3-130

Lineage for d1yked1 (1yke D:3-130)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
   6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure

4. Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families)

5. Family a.252.1.1: CSE2-like [140719] (1 protein)
   Pfam PF07544

6. Protein RNA polymerase II holoenzyme component SRB7 (MED21) [140720] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140721] (2 PDB entries)

8. Domain d1yked1: 1yke D:3-130 [123516]
   Other proteins in same PDB: d1ykea1, d1ykec1
   automatically matched to 1YKE B:3-133

Details for d1yked1

PDB Entry: 1yke, 3.3 Å

PDB Description: Structure of the mediator MED7/MED21 subcomplex

PDB Compounds: (D:) RNA polymerase II holoenzyme component SRB7

SCOP Domain Sequences for d1yked1:

Sequence, based on SEQRES records:

>d1yked1 a.252.1.1 (D:3-130) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drltqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntidel
stdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhv
dsliedfv

Sequence, based on observed residues (ATOM records):

>d1yked1 a.252.1.1 (D:3-130) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drltqlqicldqmteqfcatlnyidknhgfevvppeefsntidelstdiilktrqinkli
dslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhvdsliedfv

Timeline for d1yked1:

• d1yked1 is new in SCOP 1.73
  
• d1yked1 appears in SCOP 1.75
  
• d1yked1 appears in the current release, SCOPe 2.08