SCOP 1.73: Domain d1ykec1: 1yke C:108-205

Lineage for d1ykec1 (1yke C:108-205)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
   6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure

4. Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families)

5. Family a.252.1.2: MED7 hinge region [140722] (1 protein)
   C-terminal part of Pfam PF05983

6. Protein RNA polymerase II mediator complex protein MED7 [140723] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140724] (2 PDB entries)

8. Domain d1ykec1: 1yke C:108-205 [123515]
   Other proteins in same PDB: d1ykeb1, d1yked1
   automatically matched to 1YKE A:108-205

Details for d1ykec1

PDB Entry: 1yke, 3.3 Å

PDB Description: Structure of the mediator MED7/MED21 subcomplex

PDB Compounds: (C:) RNA polymerase II mediator complex protein MED7

SCOP Domain Sequences for d1ykec1:

Sequence; same for both SEQRES and ATOM records:

>d1ykec1 a.252.1.2 (C:108-205) RNA polymerase II mediator complex protein MED7 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
estnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrp
hqsreslimlleeqleykrgeireieqvckqvhdklts

Timeline for d1ykec1:

• d1ykec1 is new in SCOP 1.73
  
• d1ykec1 appears in SCOP 1.75
  
• d1ykec1 appears in the current release, SCOPe 2.08