![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily) 6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure |
![]() | Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) ![]() |
![]() | Family a.252.1.1: CSE2-like [140719] (1 protein) Pfam PF07544 |
![]() | Protein RNA polymerase II holoenzyme component SRB7 (MED21) [140720] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140721] (2 PDB entries) |
![]() | Domain d1ykeb1: 1yke B:3-133 [123514] Other proteins in same PDB: d1ykea1, d1ykec1 |
PDB Entry: 1yke (more details), 3.3 Å
SCOP Domain Sequences for d1ykeb1:
Sequence, based on SEQRES records: (download)
>d1ykeb1 a.252.1.1 (B:3-133) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} drltqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntidel stdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhv dsliedfvdgi
>d1ykeb1 a.252.1.1 (B:3-133) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} drltqlqicldqmteqfcatlnyidknhgferltvvppeefsntidelstdiilktrqin klidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhvdsliedfvdgi
Timeline for d1ykeb1: