Lineage for d1ykeb1 (1yke B:3-133)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016118Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
    6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure
  4. 2016119Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) (S)
  5. 2016120Family a.252.1.1: CSE2-like [140719] (1 protein)
    Pfam PF07544
  6. 2016121Protein RNA polymerase II holoenzyme component SRB7 (MED21) [140720] (1 species)
  7. 2016122Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140721] (2 PDB entries)
    Uniprot P47822 2-130! Uniprot P47822 3-133
  8. 2016124Domain d1ykeb1: 1yke B:3-133 [123514]
    Other proteins in same PDB: d1ykea1, d1ykec1

Details for d1ykeb1

PDB Entry: 1yke (more details), 3.3 Å

PDB Description: Structure of the mediator MED7/MED21 subcomplex
PDB Compounds: (B:) RNA polymerase II holoenzyme component SRB7

SCOPe Domain Sequences for d1ykeb1:

Sequence, based on SEQRES records: (download)

>d1ykeb1 a.252.1.1 (B:3-133) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drltqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntidel
stdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhv
dsliedfvdgi

Sequence, based on observed residues (ATOM records): (download)

>d1ykeb1 a.252.1.1 (B:3-133) RNA polymerase II holoenzyme component SRB7 (MED21) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drltqlqicldqmteqfcatlnyidknhgferltvvppeefsntidelstdiilktrqin
klidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhvdsliedfvdgi

SCOPe Domain Coordinates for d1ykeb1:

Click to download the PDB-style file with coordinates for d1ykeb1.
(The format of our PDB-style files is described here.)

Timeline for d1ykeb1: