Class a: All alpha proteins [46456] (290 folds) |
Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily) 6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure |
Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) |
Family a.252.1.2: MED7 hinge region [140722] (2 proteins) C-terminal part of Pfam PF05983 |
Domain d1ykea1: 1yke A:108-205 [123513] Other proteins in same PDB: d1ykeb1, d1yked1 |
PDB Entry: 1yke (more details), 3.3 Å
SCOPe Domain Sequences for d1ykea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykea1 a.252.1.2 (A:108-205) RNA polymerase II mediator complex protein MED7 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} estnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrp hqsreslimlleeqleykrgeireieqvckqvhdklts
Timeline for d1ykea1: