Lineage for d1ykea1 (1yke A:108-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738348Fold a.252: Mediator hinge subcomplex-like [140717] (1 superfamily)
    6 helices; heterodimer of structurally similar subunits; the N-terminal hairpins form a four-helical bundle, whereas the C-terminal helices form coiled coil structure
  4. 2738349Superfamily a.252.1: Mediator hinge subcomplex-like [140718] (2 families) (S)
  5. 2738356Family a.252.1.2: MED7 hinge region [140722] (2 proteins)
    C-terminal part of Pfam PF05983
  6. Protein RNA polymerase II mediator complex protein MED7 [140723] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140724] (1 PDB entry)
    Uniprot Q08278 108-205
  8. 2738359Domain d1ykea1: 1yke A:108-205 [123513]
    Other proteins in same PDB: d1ykeb1, d1yked1

Details for d1ykea1

PDB Entry: 1yke (more details), 3.3 Å

PDB Description: Structure of the mediator MED7/MED21 subcomplex
PDB Compounds: (A:) RNA polymerase II mediator complex protein MED7

SCOPe Domain Sequences for d1ykea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykea1 a.252.1.2 (A:108-205) RNA polymerase II mediator complex protein MED7 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
estnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrp
hqsreslimlleeqleykrgeireieqvckqvhdklts

SCOPe Domain Coordinates for d1ykea1:

Click to download the PDB-style file with coordinates for d1ykea1.
(The format of our PDB-style files is described here.)

Timeline for d1ykea1: