Lineage for d1ykcb2 (1ykc B:1-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699397Protein Class mu GST [81359] (3 species)
  7. 699405Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
  8. 699416Domain d1ykcb2: 1ykc B:1-84 [123512]
    Other proteins in same PDB: d1ykca1, d1ykcb1
    automatically matched to d1hna_2
    complexed with gds

Details for d1ykcb2

PDB Entry: 1ykc (more details), 2.1 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with glutathione-disulfide
PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOP Domain Sequences for d1ykcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykcb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOP Domain Coordinates for d1ykcb2:

Click to download the PDB-style file with coordinates for d1ykcb2.
(The format of our PDB-style files is described here.)

Timeline for d1ykcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ykcb1