Lineage for d1ykbf_ (1ykb F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705872Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 2705873Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)
  8. 2705883Domain d1ykbf_: 1ykb F: [123508]
    automated match to d1m4ra_
    complexed with nag

Details for d1ykbf_

PDB Entry: 1ykb (more details), 2.6 Å

PDB Description: crystal structure of insect cell expressed il-22
PDB Compounds: (F:) PROTEIN (Interleukin-22)

SCOPe Domain Sequences for d1ykbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykbf_ a.26.1.3 (F:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci

SCOPe Domain Coordinates for d1ykbf_:

Click to download the PDB-style file with coordinates for d1ykbf_.
(The format of our PDB-style files is described here.)

Timeline for d1ykbf_: