SCOP 1.73: Domain d1ykbe1: 1ykb E:39-179

Lineage for d1ykbe1 (1ykb E:39-179)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (2 PDB entries)

8. Domain d1ykbe1: 1ykb E:39-179 [123507]
   automatically matched to d1m4ra_
   complexed with fuc, man, nag

Details for d1ykbe1

PDB Entry: 1ykb, 2.6 Å

PDB Description: crystal structure of insect cell expressed il-22

PDB Compounds: (E:) PROTEIN (Interleukin-22)

SCOP Domain Sequences for d1ykbe1:

Sequence; same for both SEQRES and ATOM records:

>d1ykbe1 a.26.1.3 (E:39-179) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
geikaigeldllfmslrnaci

Timeline for d1ykbe1:

• d1ykbe1 is new in SCOP 1.73
  
• d1ykbe1 appears in SCOP 1.75
  
• d1ykbe1 appears in the current release, SCOPe 2.08, called d1ykbe_