Lineage for d1ykbe1 (1ykb E:39-179)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 639437Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 639600Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 639667Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 639668Species Human (Homo sapiens) [TaxId:9606] [89037] (2 PDB entries)
  8. 639675Domain d1ykbe1: 1ykb E:39-179 [123507]
    automatically matched to d1m4ra_
    complexed with fuc, man, nag

Details for d1ykbe1

PDB Entry: 1ykb (more details), 2.6 Å

PDB Description: crystal structure of insect cell expressed il-22
PDB Compounds: (E:) PROTEIN (Interleukin-22)

SCOP Domain Sequences for d1ykbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykbe1 a.26.1.3 (E:39-179) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
geikaigeldllfmslrnaci

SCOP Domain Coordinates for d1ykbe1:

Click to download the PDB-style file with coordinates for d1ykbe1.
(The format of our PDB-style files is described here.)

Timeline for d1ykbe1: