SCOPe 2.08: Domain d1ykbe_: 1ykb E:

Lineage for d1ykbe_ (1ykb E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)

8. Domain d1ykbe_: 1ykb E: [123507]
   automated match to d1m4ra_
   complexed with nag

Details for d1ykbe_

PDB Entry: 1ykb, 2.6 Å

PDB Description: crystal structure of insect cell expressed il-22

PDB Compounds: (E:) PROTEIN (Interleukin-22)

SCOPe Domain Sequences for d1ykbe_:

Sequence; same for both SEQRES and ATOM records:

>d1ykbe_ a.26.1.3 (E:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci

Timeline for d1ykbe_:

• d1ykbe_ first appeared in SCOP 1.73, called d1ykbe1
  
• d1ykbe_ appears in SCOPe 2.07