Lineage for d1ykbd_ (1ykb D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991729Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 protein domains)
    contains an additional helix in one of the crossover connections
  6. 1991814Protein Interleukin-22 (IL-22) [89036] (1 species)
  7. 1991815Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)
  8. 1991823Domain d1ykbd_: 1ykb D: [123506]
    automated match to d1m4ra_
    complexed with nag

Details for d1ykbd_

PDB Entry: 1ykb (more details), 2.6 Å

PDB Description: Crystal Structure of Insect Cell Expressed IL-22
PDB Compounds: (D:) PROTEIN (Interleukin-22)

SCOPe Domain Sequences for d1ykbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykbd_ a.26.1.3 (D:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
sgeikaigeldllfmslrnaci

SCOPe Domain Coordinates for d1ykbd_:

Click to download the PDB-style file with coordinates for d1ykbd_.
(The format of our PDB-style files is described here.)

Timeline for d1ykbd_: