SCOP 1.75: Domain d1yk8a1: 1yk8 A:117-329

Lineage for d1yk8a1 (1yk8 A:117-329)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (31 PDB entries)
   Uniprot P43235 116-329
   Uniprot P43235 115-329
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1yk8a1: 1yk8 A:117-329 [123502]
   automatically matched to d1atk__
   complexed with t2m

Details for d1yk8a1

PDB Entry: 1yk8, 2.6 Å

PDB Description: Cathepsin K complexed with a cyanamide-based inhibitor

PDB Compounds: (A:) cathepsin k

SCOP Domain Sequences for d1yk8a1:

Sequence; same for both SEQRES and ATOM records:

>d1yk8a1 d.3.1.1 (A:117-329) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
dsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsendg
cgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekalk
ravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiikn
swgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1yk8a1:

• d1yk8a1 first appeared in SCOP 1.73
  
• d1yk8a1 appears in SCOPe 2.01
  
• d1yk8a1 appears in the current release, SCOPe 2.08, called d1yk8a_