Lineage for d1yk7a_ (1yk7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926617Protein (Pro)cathepsin K [54028] (3 species)
  7. 2926618Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 2926647Domain d1yk7a_: 1yk7 A: [123501]
    automated match to d2r6na1
    complexed with nbl

Details for d1yk7a_

PDB Entry: 1yk7 (more details), 2.5 Å

PDB Description: Cathepsin K complexed with a cyanopyrrolidine inhibitor
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1yk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk7a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d1yk7a_:

Click to download the PDB-style file with coordinates for d1yk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1yk7a_: