Lineage for d1yk3c1 (1yk3 C:11-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731138Protein Hypothetical protein Rv1347c/MT1389 [143668] (1 species)
  7. 731139Species Mycobacterium tuberculosis [TaxId:1773] [143669] (1 PDB entry)
  8. 731142Domain d1yk3c1: 1yk3 C:11-207 [123495]
    automatically matched to 1YK3 A:10-207
    complexed with bog

Details for d1yk3c1

PDB Entry: 1yk3 (more details), 2.2 Å

PDB Description: crystal structure of rv1347c from mycobacterium tuberculosis
PDB Compounds: (C:) Hypothetical protein Rv1347c/MT1389

SCOP Domain Sequences for d1yk3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk3c1 d.108.1.1 (C:11-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}
ddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaawe
ydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglh
aaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflge
hdttnrrmalyaleapt

SCOP Domain Coordinates for d1yk3c1:

Click to download the PDB-style file with coordinates for d1yk3c1.
(The format of our PDB-style files is described here.)

Timeline for d1yk3c1: